LL-37
$40.00
Free shipping on orders over $150!
- Secure Payments
- Venmo Payments
- Credit Cards
🛡️ LL-37
Available to order right here on Coast Peptides. Formulated using strict quality standards to guarantee potent compounds free from impurities and contamination.
🔍 Key Features
- 🧬 >99% Purity
- 📉 Third-Party Testing
- 🧪 Sterilized Vials
- ⚙️ Lyophilized Format: Stable and reconstitutable with minimal degradation
Product Name | LL-37 | |
CAS Number | 22150-29-6 | |
Sequence | [LL-37, 37 aa] | |
Molecular Formula | C₁₉₈H₃₁₇N₅₅O₅₀ | |
Molecular Weight | 4493.26 g/mol | |
Purity | ≥98% (HPLC validated) | |
Synthesis Method | Solid-phase peptide synthesis (SPPS) | |
Format | Lyophilized powder | |
Appearance | White to off-white crystalline powder | |
Solubility | Soluble in sterile water or PBS | |
Stability & Storage | −20°C for 24 months; post-reconstitution: 4°C ≤7 days | −20°C ≤3 months |
Shipping Conditions | Ambient temperature; refrigerate upon receipt | |
Regulatory Status | For research use only; non-therapeutic grade |
The products offered by Coast Peptides are intended strictly for laboratory research purposes only and are sold exclusively to qualified professionals, institutions, and entities. These products are not for human consumption, veterinary use, or any other application involving living organisms, including but not limited to diagnostic, therapeutic, or recreational purposes.
By purchasing this product, you confirm that:
- You are a qualified professional or entity with the necessary knowledge, training, and facilities to handle chemical reagents safely and appropriately.
- You will use this product in full compliance with all applicable local, state, and federal laws and regulations.
Prohibited Uses:
- This product is not to be used as an active pharmaceutical ingredient (API) in compounding or manufacturing drugs for human or veterinary use.
- It is strictly prohibited to use this product for administration to humans or animals under any circumstances.
- Coast Peptides does not condone or permit the use of its products for the development, testing, or production of illegal substances.
Regulatory Compliance:
Coast Peptides does not claim that this product is approved by the U.S. Food and Drug Administration (FDA) for any purpose. The statements regarding this product have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Liability Statement:
The buyer assumes full responsibility for ensuring the safe handling, storage, and use of this product. Coast Peptides is not liable for any damages, direct or indirect, resulting from improper handling, storage, or unauthorized use of this product. Furthermore, Coast Peptides reserves the right to refuse sales to any individual or entity suspected of misusing its products.
If you have questions about the safe and lawful use of this product, consult a qualified professional with expertise in laboratory research. By proceeding with this purchase, you agree to these terms and conditions.